Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP14 protein

This Human PARP14 protein spans the amino acid sequence from region 1605-1801aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 8 B aggressive lymphoma protein 2 Poly [ADP-ribose] polymerase 14

UniProt

Q460N5

Expression Region

1605-1801aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOG Rabbit Polyclonal Antibody (PE)
orb495248 100 µL

MOG Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
LOC498154 Protein Vector (Rat) (pPB-N-His)
PV278579 500 ng

LOC498154 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
B-Raf IN 1 50mg
A21055-50 50 mg

B-Raf IN 1 50mg

Sign In for Pricing
View Details
Human KIF4A qPCR Primer Pair
QH08133S 200 Tests

Human KIF4A qPCR Primer Pair

Sign In for Pricing
View Details
Zfp119b shRNA Plasmid (m)
sc-141566-SH 20 µg

Zfp119b shRNA Plasmid (m)

Sign In for Pricing
View Details
HSPA1A (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A) discontinued
211369-01 50 µL

HSPA1A (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A) discontinued

Sign In for Pricing
View Details