Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reovirus type 3 Outer capsid protein sigma-3 protein

This Reovirus type 3 Outer capsid protein sigma-3 protein spans the amino acid sequence from region 1-365aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P03527

Expression Region

1-365aa

Tag

Tag-Free

Source

E.coli

Origin

Reovirus type 3 (strain Dearing) (T3D) (Mammalian orthoreovirus 3)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVCLPNGHQVVDLINNAFEGRVSIYSAQEGWDKTISAQPDMMVCGGAVVCMHCLGVVGSLQRKLKHLPHHRCNQQIRHQDYVDVQFADRVTAHWKRGMLSFVAQMHEMMNDVSPDDLDRVRTEGGSLVELNWLQVDPNSMFRSIHSSWTDPLQVVDDLDTKLDQYWTALNLMIDSSDLIPNFMMRDPSHAFNGVKLGGDARQTQFSRTFDSRSSLEWGVMVYDYSELEHDPSKGRAYRKELVTPARDFGHFGLSHYSRATTPILGKMPAVFSGMLTGNCKMYPFIKGTAKLKTVRKLVEAVNHAWGVEKIRYALGPGGMTGWYNRTMQQAPIVLTPAALTMFPDTIKFGDLNYPVMIGDPMILG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAA9 CRISPRa sgRNA lentivector (set of three targets)(Human)
47922121 3x 1.0µg DNA

TRNAA9 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ACRC Double Nickase Plasmid (h2)
sc-413984-NIC-2 20 µg

ACRC Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
APP, phosphorylated (Ser730) (Amyloid beta A4 Protein, APP, ABPP, Alzheimer Disease Amyloid Protein, Cerebral Vascular Amyloid Peptide, CVAP, Protease Nexin-II, PN-II, APPI, PreA4, A4, AD1) (APC) discontinued
A2275-85L-APC 200 µL

APP, phosphorylated (Ser730) (Amyloid beta A4 Protein, APP, ABPP, Alzheimer Disease Amyloid Protein, Cerebral Vascular Amyloid Peptide, CVAP, Protease Nexin-II, PN-II, APPI, PreA4, A4, AD1) (APC) discontinued

Sign In for Pricing
View Details
Porcine Coronin-7 (CORO7) ELISA Kit
MBS7209862-01 48 Well

Porcine Coronin-7 (CORO7) ELISA Kit

Sign In for Pricing
View Details
Porcine Coronin-7 (CORO7) ELISA Kit
MBS7209862-02 96 Well

Porcine Coronin-7 (CORO7) ELISA Kit

Sign In for Pricing
View Details
Porcine Coronin-7 (CORO7) ELISA Kit
MBS7209862-03 5x 96 Well

Porcine Coronin-7 (CORO7) ELISA Kit

Sign In for Pricing
View Details