Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sncg protein

This Rat Sncg protein spans the amino acid sequence from region 1-123aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Persyn Sensory neuron synuclein

UniProt

Q63544

Expression Region

1-123aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF-2BP2 CRISPR Activation Plasmid (h)
sc-406153-ACT 20 µg

IRF-2BP2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
SMAP2, ID (SMAP2, SMAP1L, Stromal membrane-associated protein 2, Stromal membrane-associated protein 1-like) (MaxLight 405) discontinued
042031-ML405 100 µL

SMAP2, ID (SMAP2, SMAP1L, Stromal membrane-associated protein 2, Stromal membrane-associated protein 1-like) (MaxLight 405) discontinued

Sign In for Pricing
View Details
β-defensin 20 CRISPR Activation Plasmid (m)
sc-435635-ACT 20 µg

β-defensin 20 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas acidophila Light-harvesting protein B-800/820 alpha chain, partial
MBS1208885-01 1 mg (E-Coli)

Recombinant Rhodopseudomonas acidophila Light-harvesting protein B-800/820 alpha chain, partial

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas acidophila Light-harvesting protein B-800/820 alpha chain, partial
MBS1208885-02 1 mg (Yeast)

Recombinant Rhodopseudomonas acidophila Light-harvesting protein B-800/820 alpha chain, partial

Sign In for Pricing
View Details
ASH2L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
TA810988BM 100 µL

ASH2L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]

Sign In for Pricing
View Details