Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sncg protein

This Rat Sncg protein spans the amino acid sequence from region 1-123aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Persyn Sensory neuron synuclein

UniProt

Q63544

Expression Region

1-123aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3TC2 Polyclonal Antibody
BT-AP08283-01 20 µL

SH3TC2 Polyclonal Antibody

Sign In for Pricing
View Details
SH3TC2 Polyclonal Antibody
BT-AP08283-02 50 µL

SH3TC2 Polyclonal Antibody

Sign In for Pricing
View Details
SH3TC2 Polyclonal Antibody
BT-AP08283-03 100 µL

SH3TC2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNJ8 Knockout HAP1 Polyclonal Cells
ARG22949 1 Million

KCNJ8 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
STAT1 Antibody
A15494-100UG 100 µg

STAT1 Antibody

Sign In for Pricing
View Details
TCEAL7 siRNA (Mouse)
orb1833964-01 15 nmol

TCEAL7 siRNA (Mouse)

Sign In for Pricing
View Details