Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coronavirus OC43 Nucleo protein

This coronavirus OC43 Nucleo protein spans the amino acid sequence from region 1-448aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

P33469

Expression Region

1-448aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human coronavirus OC43 (HCoV-OC43)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

55.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFTPGKQSSSRASSGNRSGNGILKWADQSDQVRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGPPIAPGVPATEAKGYWYRHNRGSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKHTAKEVRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGHKNGQGENDNISVAVPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 (ROR2/1911), CF647 conjugate, 0.1mg/mL
BNC471911-100 1x 100 µL

ROR2 (ROR2/1911), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM82A1 (RMDN2) Human Gene Knockout Kit (CRISPR)
KN214471BN 1 Kit

FAM82A1 (RMDN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rho GTPase activating protein 24 (ARHGAP24) (NM_001025616) Human Over-expression Lysate
LY422457 100 µg

Rho GTPase activating protein 24 (ARHGAP24) (NM_001025616) Human Over-expression Lysate

Sign In for Pricing
View Details
LRRC62 (ELFN2) Human Gene Knockout Kit (CRISPR)
KN420470 1 Kit

LRRC62 (ELFN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alppl2 Mouse Gene Knockout Kit (CRISPR)
KN501168 1 Kit

Alppl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Luteinizing Hormone beta (LH beta) (LHb/1214), Biotin conjugate, 0.1mg/mL
BNCB1214-100 1x 100 µL

Luteinizing Hormone beta (LH beta) (LHb/1214), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details