Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human coronavirus HKU1 Nucleo protein

This Human coronavirus HKU1 Nucleo protein spans the amino acid sequence from region 1-441aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein

UniProt

Q0ZME3

Expression Region

1-441aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

53.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYTPGHHAGSRSSSGNRSGILKKTSWVDQSERSHQTYNRGRKPQPKFTVSTQPQGNPIPHYSWFSGITQFQKGRDFKFPDGQGVPIAYGIPPSEAKGYWYKHNRRSFKTADGQQKQLLPRWYFYYLGTGPYASSSYGDAHEGIFWVASHQADTSIPSDVSARDPTIQEAIPTRFSPGTILPQGYYVEGSGRSASNSRPGSRSQSRGPNNRSLSRSNSNFRHSDSIVKPDMADEIASLVLAKLGKDSKPQQVTKQNAKEIRHKILMKPRQKRTPNKFCNVQQCFGKRGPLQNFGNSEMLKLGTNDPQFPILAELAPTPGAFFFGSKLELFKRDSDADSPSKDTFELRYSGSIRFDSTLPGFETIMKVLKENLDAYVNSNQNTVSGSLSPKPQRKRGVKQSPESFDSLNLSADTQHISNDFTPEDHSLLATLDDPYVEDSVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Desacyl Ghrelin ELISA Kit
MBS035848 Inquire

Goat Desacyl Ghrelin ELISA Kit

Sign In for Pricing
View Details
Anti-PC4/SUB1 Antibody, Mouse Monoclonal
MBS8107312-01 0.1 mL

Anti-PC4/SUB1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-PC4/SUB1 Antibody, Mouse Monoclonal
MBS8107312-02 5x 0.1 mL

Anti-PC4/SUB1 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
pOTB7-FOXRED1 Plasmid
PVT28848 2 µg

pOTB7-FOXRED1 Plasmid

Sign In for Pricing
View Details
Recombinant Streptococcus suis Probable tRNA sulfurtransferase (thiI)
MBS1019853-01 0.02 mg (E-Coli)

Recombinant Streptococcus suis Probable tRNA sulfurtransferase (thiI)

Sign In for Pricing
View Details
Recombinant Streptococcus suis Probable tRNA sulfurtransferase (thiI)
MBS1019853-02 0.02 mg (Yeast)

Recombinant Streptococcus suis Probable tRNA sulfurtransferase (thiI)

Sign In for Pricing
View Details