Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CNTNAP2 protein

Recombinant Human Contactin-associated protein-like 2 (CNTNAP2), partial

Product Specifications

Product Name Alternative

Cell recognition molecule Caspr2

UniProt

Q9UHC6

Expression Region

35-181aa

Reactivity

Human

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDEPLVSGLPHVAFSSSSSISGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAIATQGRYSSSDWVTQYRMLYSDTGRNWKPYHQDGNIWAFPGNINSDGVVRHELQHPIIARYVRIVPLDWNGEGRIGLRIEVYGC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIF1 beta (Phospho-Ser824) Rabbit Polyclonal Antibody
BT-AP05110-01 20 µL

TIF1 beta (Phospho-Ser824) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIF1 beta (Phospho-Ser824) Rabbit Polyclonal Antibody
BT-AP05110-02 50 µL

TIF1 beta (Phospho-Ser824) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIF1 beta (Phospho-Ser824) Rabbit Polyclonal Antibody
BT-AP05110-03 100 µL

TIF1 beta (Phospho-Ser824) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal LMO3 Antibody (monoclonal) (M04), Clone: 4B9
AMM03744G 0.1mg

Monoclonal LMO3 Antibody (monoclonal) (M04), Clone: 4B9

Sign In for Pricing
View Details
Zfp148 Mouse shRNA Lentiviral Particle (Locus ID 22661)
TL515763V 500 µL Each

Zfp148 Mouse shRNA Lentiviral Particle (Locus ID 22661)

Sign In for Pricing
View Details
Rabbit Polyclonal PPIG Antibody [Alexa Fluor 750]
NBP2-98654AF750 0.1 mL

Rabbit Polyclonal PPIG Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details