Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli oppA protein

This E. coli oppA protein spans the amino acid sequence from region 27-543aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P23843

Expression Region

27-543aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC16/ZNF83 Antibody Blocking Peptide
orb1501616 500 µg

CCDC16/ZNF83 Antibody Blocking Peptide

Sign In for Pricing
View Details
Agxt-set siRNA/shRNA/RNAi Lentivector (Rat)
11548096 4x 500 ng

Agxt-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Chicken Calcium activated chloride channel regulator 1 (CLCA1) ELISA Kit
GTR10334822 96 Well

Chicken Calcium activated chloride channel regulator 1 (CLCA1) ELISA Kit

Sign In for Pricing
View Details
ERCC2 Polyclonal Antibody
E-AB-61805-01 60 µL

ERCC2 Polyclonal Antibody

Sign In for Pricing
View Details
ERCC2 Polyclonal Antibody
E-AB-61805-02 120 µL

ERCC2 Polyclonal Antibody

Sign In for Pricing
View Details
ERCC2 Polyclonal Antibody
E-AB-61805-03 200 µL

ERCC2 Polyclonal Antibody

Sign In for Pricing
View Details