Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RT0041 protein

This RT0041 protein spans the amino acid sequence from region 70-147aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q68XW4

Expression Region

70-147aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pax-8 rabbit pAb
ES3154-01 50 µL

Pax-8 rabbit pAb

Sign In for Pricing
View Details
Pax-8 rabbit pAb
ES3154-02 100 µL

Pax-8 rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal TSPAN1 Antibody (4/12) [Janelia Fluor 646]
NBP3-12060JF646 0.1 mL

Mouse Monoclonal TSPAN1 Antibody (4/12) [Janelia Fluor 646]

Sign In for Pricing
View Details
SYK (Tyrosine-protein Kinase SYK, Spleen Tyrosine Kinase, DKFZp313N1010, FLJ25043, FLJ37489) (MaxLight 490)
MBS6395747-01 0.1 mL

SYK (Tyrosine-protein Kinase SYK, Spleen Tyrosine Kinase, DKFZp313N1010, FLJ25043, FLJ37489) (MaxLight 490)

Sign In for Pricing
View Details
SYK (Tyrosine-protein Kinase SYK, Spleen Tyrosine Kinase, DKFZp313N1010, FLJ25043, FLJ37489) (MaxLight 490)
MBS6395747-02 5x 0.1 mL

SYK (Tyrosine-protein Kinase SYK, Spleen Tyrosine Kinase, DKFZp313N1010, FLJ25043, FLJ37489) (MaxLight 490)

Sign In for Pricing
View Details
Nexviazyme/Avalglucosidase alfa Biosimilar (Monoclonal, )
A136848 100 µL

Nexviazyme/Avalglucosidase alfa Biosimilar (Monoclonal, )

Sign In for Pricing
View Details