Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RT0041 protein

This RT0041 protein spans the amino acid sequence from region 70-147aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q68XW4

Expression Region

70-147aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFX5 antibody - N-terminal region (ARP37992_T100)
ARP37992_T100 100 µL

RFX5 antibody - N-terminal region (ARP37992_T100)

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-383-5p Vector
mh30699 500 ng

LentimiRa-Off-hsa-miR-383-5p Vector

Sign In for Pricing
View Details
RN5S132 Protein Lysate (Human) with C-Ha Tag
39688031 100 µg

RN5S132 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PYGM Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2414370 100 µL

PYGM Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Tet-inducible Cas9 lentivirus (EF1a-rtTA, Neo) - Tet-inducible Cas9 lentivirus (EF1a-rtTA, Neo)
GTR15425109 100 µL (4x 25 µL)

Tet-inducible Cas9 lentivirus (EF1a-rtTA, Neo) - Tet-inducible Cas9 lentivirus (EF1a-rtTA, Neo)

Sign In for Pricing
View Details
Anti-CAPN6 Rabbit Polyclonal Antibody
orb2569713 100 µg

Anti-CAPN6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details