Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli Escherichia phage lambda Capsid decoration protein

This E. coli Escherichia phage lambda Capsid decoration protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Auxiliary protein D Gene product D Major capsid protein D

UniProt

P03712

Expression Region

1-110aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia phage lambda (Bacteriophage lambda)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM98B ORF Vector (Human) (pORF)
ORF019469 1.0 µg DNA

FAM98B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
LentimiRa-mmu-miR-7222-5p Vector
mm41961 500 ng

LentimiRa-mmu-miR-7222-5p Vector

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar L2 UPF0301 protein CTL0463 (CTL0463)
MBS1027881-01 0.02 mg (E-Coli)

Recombinant Chlamydia trachomatis serovar L2 UPF0301 protein CTL0463 (CTL0463)

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar L2 UPF0301 protein CTL0463 (CTL0463)
MBS1027881-02 0.1 mg (E-Coli)

Recombinant Chlamydia trachomatis serovar L2 UPF0301 protein CTL0463 (CTL0463)

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar L2 UPF0301 protein CTL0463 (CTL0463)
MBS1027881-03 0.02 mg (Yeast)

Recombinant Chlamydia trachomatis serovar L2 UPF0301 protein CTL0463 (CTL0463)

Sign In for Pricing
View Details
Recombinant Chlamydia trachomatis serovar L2 UPF0301 protein CTL0463 (CTL0463)
MBS1027881-04 0.1 mg (Yeast)

Recombinant Chlamydia trachomatis serovar L2 UPF0301 protein CTL0463 (CTL0463)

Sign In for Pricing
View Details