Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MYLK protein

This Human MYLK protein spans the amino acid sequence from region 1464-1719aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kinase-related protein

UniProt

Q15746

Expression Region

1464-1719aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL30P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
30465061 1.0 µg DNA

MRPL30P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LIMCH1 Rabbit pAb
E45R23865N-50 50 µL

LIMCH1 Rabbit pAb

Sign In for Pricing
View Details
MPZL2 antibody - N-terminal region
MBS3208279-01 0.1 mL

MPZL2 antibody - N-terminal region

Sign In for Pricing
View Details
MPZL2 antibody - N-terminal region
MBS3208279-02 5x 0.1 mL

MPZL2 antibody - N-terminal region

Sign In for Pricing
View Details
Sash1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4685703 1.0 µg DNA

Sash1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CDKN1B Polyclonal Antibody
ANT-11438-50ug 50 µg

CDKN1B Polyclonal Antibody

Sign In for Pricing
View Details