Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Slc2a1 protein

This Mouse Slc2a1 protein spans the amino acid sequence from region 451-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucose transporter type 1, erythrocyte/brain

UniProt

P17809

Expression Region

451-492aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

4.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGK Assay Kit (UV Spectrophotometry)
orb3131862 50 Tests

PGK Assay Kit (UV Spectrophotometry)

Sign In for Pricing
View Details
Anti-MSP receptor Antibody (8H796)
TMAS-00381-01 50 μL

Anti-MSP receptor Antibody (8H796)

Sign In for Pricing
View Details
Anti-MSP receptor Antibody (8H796)
TMAS-00381-02 100 µL

Anti-MSP receptor Antibody (8H796)

Sign In for Pricing
View Details
SHROOM1 Rabbit Polyclonal Antibody (BF555)
orb2521900 100 µL

SHROOM1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Pyloricidin A
orb3024120-01 10 mg

Pyloricidin A

Sign In for Pricing
View Details
Pyloricidin A
orb3024120-02 50 mg

Pyloricidin A

Sign In for Pricing
View Details