Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Slc2a1 protein

This Mouse Slc2a1 protein spans the amino acid sequence from region 451-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucose transporter type 1, erythrocyte/brain

UniProt

P17809

Expression Region

451-492aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

4.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADSQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPGM Blocking Peptide
MBS9632531-01 1 mg

BPGM Blocking Peptide

Sign In for Pricing
View Details
BPGM Blocking Peptide
MBS9632531-02 5x 1 mg

BPGM Blocking Peptide

Sign In for Pricing
View Details
Dazcapistat
BA8293-25 25 mg

Dazcapistat

Sign In for Pricing
View Details
Rabbit UBR4 (Ubiquitin Protein Ligase E3 Component N-Recognin 4) ValidElisa Kit
EK346742 96 Well

Rabbit UBR4 (Ubiquitin Protein Ligase E3 Component N-Recognin 4) ValidElisa Kit

Sign In for Pricing
View Details
Hsa-miR-3689a-5p inhibitor
HY-RI00806-01 5 nmol

Hsa-miR-3689a-5p inhibitor

Sign In for Pricing
View Details
Hsa-miR-3689a-5p inhibitor
HY-RI00806-02 20 nmol

Hsa-miR-3689a-5p inhibitor

Sign In for Pricing
View Details