Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MUC21 protein

This Human MUC21 protein spans the amino acid sequence from region 501-566aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epiglycanin

UniProt

Q5SSG8

Expression Region

501-566aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNSGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH2 Double Nickase Plasmid (h)
sc-406270-NIC 20 µg

PCDH2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
TSLC1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-6026R-BF405-TR 20 µL

TSLC1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Ankle2 (NM_027922) Mouse Tagged ORF Clone Lentiviral Particle
MR211330L4V 200 µL

Ankle2 (NM_027922) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GMFG (NM_004877) Human Recombinant Protein
PROTO60234 20 µg

GMFG (NM_004877) Human Recombinant Protein

Sign In for Pricing
View Details
BIRC7, Active
MBS516627-01 0.02 mg

BIRC7, Active

Sign In for Pricing
View Details
BIRC7, Active
MBS516627-02 0.1 mg

BIRC7, Active

Sign In for Pricing
View Details