Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MUC21 protein

This Human MUC21 protein spans the amino acid sequence from region 501-566aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epiglycanin

UniProt

Q5SSG8

Expression Region

501-566aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRPRWSPNWFWRRPVSSIAMEMSGRNSGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf40 (19L2) Mouse Monoclonal antibody
E28PE4868 100 µL

C2orf40 (19L2) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Human Solute Carrier Family 25 Member 45 (SLC25A45) ELISA Kit
abx383255 96 Tests

Human Solute Carrier Family 25 Member 45 (SLC25A45) ELISA Kit

Sign In for Pricing
View Details
CRALBP Recombinant Rabbit mAb
E43S48608 100 µL

CRALBP Recombinant Rabbit mAb

Sign In for Pricing
View Details
JAK3 Rabbit pAb
APA4522-01 30 µL

JAK3 Rabbit pAb

Sign In for Pricing
View Details
JAK3 Rabbit pAb
APA4522-02 50 μL

JAK3 Rabbit pAb

Sign In for Pricing
View Details
JAK3 Rabbit pAb
APA4522-03 100 µL

JAK3 Rabbit pAb

Sign In for Pricing
View Details