Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDF1.2A protein

This PDF1.2A protein spans the amino acid sequence from region 30-80aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Low-molecular-weight cysteine-rich protein 77

UniProt

Q9FI23

Expression Region

30-80aa

Tag

Tag-Free

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

5.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal UGT1A6 Antibody [mFluor Violet 610 SE]
NBP2-97897MFV610 0.1 mL

Rabbit Polyclonal UGT1A6 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Complete Medium for MIA PaCa-2 Cells
abx703721 500 mL

Complete Medium for MIA PaCa-2 Cells

Sign In for Pricing
View Details
Platelet Derived Growth Factor Receptor Beta (PDGFRB) Antibody
abx329506-01 50 µg

Platelet Derived Growth Factor Receptor Beta (PDGFRB) Antibody

Sign In for Pricing
View Details
Platelet Derived Growth Factor Receptor Beta (PDGFRB) Antibody
abx329506-02 100 µg

Platelet Derived Growth Factor Receptor Beta (PDGFRB) Antibody

Sign In for Pricing
View Details
Human NF1 Knockout HEK293T cell line
GTR15404107 1 Vial

Human NF1 Knockout HEK293T cell line

Sign In for Pricing
View Details
COX5A Antibody (N-term)
MBS9215225-01 0.08 mL

COX5A Antibody (N-term)

Sign In for Pricing
View Details