Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDF1.2A protein

This PDF1.2A protein spans the amino acid sequence from region 30-80aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Low-molecular-weight cysteine-rich protein 77

UniProt

Q9FI23

Expression Region

30-80aa

Tag

Tag-Free

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

5.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF200 antibody
10R-7882 0.1 mg

NF200 antibody

Sign In for Pricing
View Details
Stainless steel dissecting scissors ultra-fine length 12 cm
DD5068 1 Each

Stainless steel dissecting scissors ultra-fine length 12 cm

Sign In for Pricing
View Details
Recombinant Human CD118/LIFR Protein, C-His
AP93845 50 µg

Recombinant Human CD118/LIFR Protein, C-His

Sign In for Pricing
View Details
BC026585 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
13109124 3x 1.0µg DNA

BC026585 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Recombinant Human CD3E protein, C-mFc Tag
IMP-517 10 µg

Recombinant Human CD3E protein, C-mFc Tag

Sign In for Pricing
View Details
Olfr1163 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
32633124 3x 1.0µg DNA

Olfr1163 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details