Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human METTL7B protein

This Human METTL7B protein spans the amino acid sequence from region 24-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6UX53

Expression Region

24-244aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEDD4 2 (NEDD4L) Rabbit Polyclonal Antibody
TA379036 100 µL

NEDD4 2 (NEDD4L) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PICK1 Rabbit Polyclonal Antibody
ER1902-97 100 µL

PICK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAK (PTK2) Rabbit Polyclonal Antibody
AP06600PU-N 100 µg

FAK (PTK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRM3 Antibody
OC-912-01 50 μL

MRM3 Antibody

Sign In for Pricing
View Details
MRM3 Antibody
OC-912-02 100 µL

MRM3 Antibody

Sign In for Pricing
View Details
MRM3 Antibody
OC-912-03 1 mL

MRM3 Antibody

Sign In for Pricing
View Details