Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human METTL7B protein

This Human METTL7B protein spans the amino acid sequence from region 24-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q6UX53

Expression Region

24-244aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLGCWQPLCKSYFPYLMAVLTPKSNRKMESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF1B Rabbit Polyclonal Antibody
TA385431 100 µL

TNFRSF1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Benzyloxycarbonyl-D-serine
TRC-B286730-250MG 250 mg

N-Benzyloxycarbonyl-D-serine

Sign In for Pricing
View Details
EIF3CL Human Gene Knockout Kit (CRISPR)
KN423143 1 Kit

EIF3CL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AQP4 Monoclonal Antibody
E-AB-22025-01 20 µL

AQP4 Monoclonal Antibody

Sign In for Pricing
View Details
AQP4 Monoclonal Antibody
E-AB-22025-02 60 µL

AQP4 Monoclonal Antibody

Sign In for Pricing
View Details
AQP4 Monoclonal Antibody
E-AB-22025-03 120 µL

AQP4 Monoclonal Antibody

Sign In for Pricing
View Details