Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MGAT4A protein

This Human MGAT4A protein spans the amino acid sequence from region 93-535aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa

UniProt

Q9UM21

Expression Region

93-535aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISPPESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQHVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWAITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D6 CRISPRa sgRNA lentivector (set of three targets)(Human)
43660121 3x 1.0µg DNA

SH2D6 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Human Protein FAM9A (FAM9A)
MBS1355962-01 0.02 mg (E-Coli)

Recombinant Human Protein FAM9A (FAM9A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM9A (FAM9A)
MBS1355962-02 0.02 mg (Yeast)

Recombinant Human Protein FAM9A (FAM9A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM9A (FAM9A)
MBS1355962-03 0.1 mg (E-Coli)

Recombinant Human Protein FAM9A (FAM9A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM9A (FAM9A)
MBS1355962-04 0.1 mg (Yeast)

Recombinant Human Protein FAM9A (FAM9A)

Sign In for Pricing
View Details
Recombinant Human Protein FAM9A (FAM9A)
MBS1355962-05 0.02 mg (Baculovirus)

Recombinant Human Protein FAM9A (FAM9A)

Sign In for Pricing
View Details