Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP9 protein

This Human PARP9 protein spans the amino acid sequence from region 628-854aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 9

UniProt

Q8IXQ6

Expression Region

628-854aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS1 (Dehydrogenase/Reductase SDR Family Member 1, DKFZp586I0523, FLJ14250, FLJ25430, MGC20204, SDR19C1)
125820 50 µg

DHRS1 (Dehydrogenase/Reductase SDR Family Member 1, DKFZp586I0523, FLJ14250, FLJ25430, MGC20204, SDR19C1)

Sign In for Pricing
View Details
Panamidin dihydrochloride
orb1985497-01 100 mg

Panamidin dihydrochloride

Sign In for Pricing
View Details
Panamidin dihydrochloride
orb1985497-02 25 mg

Panamidin dihydrochloride

Sign In for Pricing
View Details
Panamidin dihydrochloride
orb1985497-03 50 mg

Panamidin dihydrochloride

Sign In for Pricing
View Details
PH-4 Rabbit Polyclonal Antibody (FITC)
orb2101101 100 µL

PH-4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CD24 Rabbit Polyclonal Antibody (BF680)
orb1606150 100 µL

CD24 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details