Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pla2g7 protein

This Mouse Pla2g7 protein spans the amino acid sequence from region 22-440aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1-alkyl-2-acetylglycerophosphocholine esterase 2-acetyl-1-alkylglycerophosphocholine esterase LDL-associated phospholipase A2

UniProt

Q60963

Expression Region

22-440aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FHWQDTSSFDFRPSVMFHKLQSVMSAAGSGHSKIPKGNGSYPVGCTDLMFGYGNESVFVRLYYPAQDQGRLDTVWIPNKEYFLGLSIFLGTPSIVGNILHLLYGSLTTPASWNSPLRTGEKYPLIVFSHGLGAFRTIYSAIGIGLASNGFIVATVEHRDRSASATYFFEDQVAAKVENRSWLYLRKVKQEESESVRKEQVQQRAIECSRALSAILDIEHGDPKENVLGSAFDMKQLKDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWMYPVNEELYSRTLQPLLFINSAKFQTPKDIAKMKKFYQPDKERKMITIKGSVHQNFDDFTFVTGKIIGNKLTLKGEIDSRVAIDLTNKASMAFLQKHLGLQKDFDQWDPLVEGDDENLIPGSPFDAVTQVPAQQHSPGSQTQN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-P2Y2 antibody
SL4180R-01 50 µL

Rabbit Anti-P2Y2 antibody

Sign In for Pricing
View Details
Rabbit Anti-P2Y2 antibody
SL4180R-02 100 µL

Rabbit Anti-P2Y2 antibody

Sign In for Pricing
View Details
Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein
E45H37376M5 20 µg

Beta crystallin S (CRYGS) (NM_017541) Human Recombinant Protein

Sign In for Pricing
View Details
Human Clara Cell Protein 16 (CC16) ELISA Kit
RDR-CC16-Hu-01 96 Tests

Human Clara Cell Protein 16 (CC16) ELISA Kit

Sign In for Pricing
View Details
Human Clara Cell Protein 16 (CC16) ELISA Kit
RDR-CC16-Hu-02 48 Tests

Human Clara Cell Protein 16 (CC16) ELISA Kit

Sign In for Pricing
View Details
Olfr983 Mouse Gene Knockout Kit (CRISPR)
KN512569 1 Kit

Olfr983 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details