Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish fibin protein

This Zebrafish fibin protein spans the amino acid sequence from region 24-210aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A1IGX5

Expression Region

24-210aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FFAGPLYPEMSNGTFHHYFVPDGYYEENDDPEKCQMLFKMMDNRKCTLDEDQDSVIRDDFTIIKRHIEDAARVLEGIGKSISFDLDGEDSYGKYLRRETTQISEAFSNSEKSLLELEVKFKQSQENELKEEHKISDDFLNMIVHTRDVLKETLDISLGLKDKHELLSLIIRSHGTRLSRLKNDYMKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1a (C1A/711), CF568 conjugate, 0.1mg/mL
BNC680711-500 1x 500 µL

CD1a (C1A/711), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trimetazidine Dihydrochloride
TRC-T795610-1G 1 g

Trimetazidine Dihydrochloride

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF568 conjugate, 0.1mg/mL
BNC681815-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCR Ranger 100bp DNA Ladder
11300 100 Loads

PCR Ranger 100bp DNA Ladder

Sign In for Pricing
View Details
GCG Polyclonal Antibody
E-AB-16421-01 20 µL

GCG Polyclonal Antibody

Sign In for Pricing
View Details
GCG Polyclonal Antibody
E-AB-16421-02 60 µL

GCG Polyclonal Antibody

Sign In for Pricing
View Details