Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lrpap1 protein

This Mouse Lrpap1 protein spans the amino acid sequence from region 248-360aa (H294F, H296F, Y297C, H305F) . Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heparin-binding protein 44

UniProt

P55302

Expression Region

248-360aa (H294F, H296F, Y297C, H305F)

Tag

N-terminal GFP-tagged and C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKFNFCQKQLEISFQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGES3 Antibody
MBS9414382-01 0.05 mL

PTGES3 Antibody

Sign In for Pricing
View Details
PTGES3 Antibody
MBS9414382-02 0.1 mL

PTGES3 Antibody

Sign In for Pricing
View Details
PTGES3 Antibody
MBS9414382-03 5x 0.1 mL

PTGES3 Antibody

Sign In for Pricing
View Details
MaxiKα Polyclonal Antibody
orb2656940-01 50 µL

MaxiKα Polyclonal Antibody

Sign In for Pricing
View Details
MaxiKα Polyclonal Antibody
orb2656940-02 100 µL

MaxiKα Polyclonal Antibody

Sign In for Pricing
View Details
Slco6d1 Protein Vector (Mouse) (pPM-C-HA)
PV231544 500 ng

Slco6d1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details