Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP9 protein

This Human PARP9 protein spans the amino acid sequence from region 628-854aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 9

UniProt

Q8IXQ6

Expression Region

628-854aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPARGC1A Antibody - middle region
MBS3224194-01 0.1 mL

PPARGC1A Antibody - middle region

Sign In for Pricing
View Details
PPARGC1A Antibody - middle region
MBS3224194-02 5x 0.1 mL

PPARGC1A Antibody - middle region

Sign In for Pricing
View Details
PARVB antibody
70R-19123 50 μL

PARVB antibody

Sign In for Pricing
View Details
CHST1 Protein Vector (Human) (pPM-C-HA)
16137021 500 ng

CHST1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lhfp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3540705 3x 1.0 µg

Lhfp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Poly Serium Antigen (PHSA) ELISA Kit
MBS269305-01 48 Well

Mouse Poly Serium Antigen (PHSA) ELISA Kit

Sign In for Pricing
View Details