Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L1R protein

This L1R protein spans the amino acid sequence from region 2-183aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Virion membrane protein M25

UniProt

P20540

Expression Region

2-183aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNPase (2',3'-cyclic Nucleotide 3'-phosphodiesterase) (MaxLight 650)
MBS6246426-01 0.1 mL

CNPase (2',3'-cyclic Nucleotide 3'-phosphodiesterase) (MaxLight 650)

Sign In for Pricing
View Details
CNPase (2',3'-cyclic Nucleotide 3'-phosphodiesterase) (MaxLight 650)
MBS6246426-02 5x 0.1 mL

CNPase (2',3'-cyclic Nucleotide 3'-phosphodiesterase) (MaxLight 650)

Sign In for Pricing
View Details
Human Mannose Phosphate Isomerase (MPI) ELISA Kit
MBS167596-01 48 Well

Human Mannose Phosphate Isomerase (MPI) ELISA Kit

Sign In for Pricing
View Details
Human Mannose Phosphate Isomerase (MPI) ELISA Kit
MBS167596-02 96 Well

Human Mannose Phosphate Isomerase (MPI) ELISA Kit

Sign In for Pricing
View Details
Human Mannose Phosphate Isomerase (MPI) ELISA Kit
MBS167596-03 5x 96 Well

Human Mannose Phosphate Isomerase (MPI) ELISA Kit

Sign In for Pricing
View Details
Human Mannose Phosphate Isomerase (MPI) ELISA Kit
MBS167596-04 10x 96 Well

Human Mannose Phosphate Isomerase (MPI) ELISA Kit

Sign In for Pricing
View Details