Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP14 protein

This Human PARP14 protein spans the amino acid sequence from region 1605-1801aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 8

UniProt

Q460N5

Expression Region

1605-1801aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAZALD1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
25306064 1.0 µg DNA

KAZALD1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
2- (1H-Pyrrol-1-yl) -1-ethanamine
sc-298028 1 mg

2- (1H-Pyrrol-1-yl) -1-ethanamine

Sign In for Pricing
View Details
MEP1A Rabbit pAb
E45R27981N 50 ul

MEP1A Rabbit pAb

Sign In for Pricing
View Details
0.3 M Hyacinth BMT Solution (BMT in anhydrous acetonitrile)
NC-0103-N002.5-001 2.5 L

0.3 M Hyacinth BMT Solution (BMT in anhydrous acetonitrile)

Sign In for Pricing
View Details
Rabbit Anti-FITC / Gold Secondary Antibody
TMAB-02065 500 μL

Rabbit Anti-FITC / Gold Secondary Antibody

Sign In for Pricing
View Details
FAM86C1 Protein Vector (Human) (pPB-N-His)
PV077650 500 ng

FAM86C1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details