Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PARP14 protein

This Human PARP14 protein spans the amino acid sequence from region 1605-1801aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 8

UniProt

Q460N5

Expression Region

1605-1801aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Dog TSH Beta Mab [14H9.E4.A4]
401053 100 µg

Anti Dog TSH Beta Mab [14H9.E4.A4]

Sign In for Pricing
View Details
Recombinant Odontella sinensis Photosystem II reaction center protein J (psbJ), partial
MBS1161417-01 1 mg (E-Coli)

Recombinant Odontella sinensis Photosystem II reaction center protein J (psbJ), partial

Sign In for Pricing
View Details
Recombinant Odontella sinensis Photosystem II reaction center protein J (psbJ), partial
MBS1161417-02 1 mg (Yeast)

Recombinant Odontella sinensis Photosystem II reaction center protein J (psbJ), partial

Sign In for Pricing
View Details
Xyloidone
MBS5772228 Inquire

Xyloidone

Sign In for Pricing
View Details
SSTR1 Double Nickase Plasmid (m)
sc-423040-NIC 20 µg

SSTR1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Frizzled-6 Overexpression Lysate (Native) - (Dry Ice)
NBP2-11473 0.1 mg

Frizzled-6 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details