Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2R1 protein

This Human PLA2R1 protein spans the amino acid sequence from region 395-530aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

180 kDa secretory phospholipase A2 receptor C-type lectin domain family 13 member C M-type receptor

UniProt

Q13018

Expression Region

395-530aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD206 discontinued
347570-01 100 µL

CD206 discontinued

Sign In for Pricing
View Details
CD206 discontinued
347570-02 200 µL

CD206 discontinued

Sign In for Pricing
View Details
Kmt5c (NM_001107475) Rat Tagged ORF Clone Lentiviral Particle
RR205798L4V 200 µL

Kmt5c (NM_001107475) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Actin, Muscle Specific Antibody Clone MSA/953, Unconjugated-100ug
MSM2-953-P1 100ug

Anti-Actin, Muscle Specific Antibody Clone MSA/953, Unconjugated-100ug

Sign In for Pricing
View Details
Mouse Polyclonal FPGT Antibody
H00008790-B01P 0.05 mg

Mouse Polyclonal FPGT Antibody

Sign In for Pricing
View Details
Fluorometholone
FF23440-01 250 mg

Fluorometholone

Sign In for Pricing
View Details