Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2R1 protein

This Human PLA2R1 protein spans the amino acid sequence from region 395-530aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

180 kDa secretory phospholipase A2 receptor C-type lectin domain family 13 member C M-type receptor

UniProt

Q13018

Expression Region

395-530aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wnk4 siRNA Oligos set (Mouse)
50442174 3x 5 nmol

Wnk4 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal WIPI2 Antibody (2A2) [DyLight 488]
NBP3-08559G 100 µL

Mouse Monoclonal WIPI2 Antibody (2A2) [DyLight 488]

Sign In for Pricing
View Details
CNTN2, ID (CNTN2, AXT, TAG1, TAX1, Contactin-2, Axonal glycoprotein TAG-1, Axonin-1, Transient axonal glycoprotein 1) (FITC) discontinued
034059-FITC 200 µL

CNTN2, ID (CNTN2, AXT, TAG1, TAX1, Contactin-2, Axonal glycoprotein TAG-1, Axonin-1, Transient axonal glycoprotein 1) (FITC) discontinued

Sign In for Pricing
View Details
Nori® Human TLR9 ELISA Kit (2 plates)
GR106122-2 2x 96 Well

Nori® Human TLR9 ELISA Kit (2 plates)

Sign In for Pricing
View Details
SHH
334181-01 50 µL

SHH

Sign In for Pricing
View Details
SHH
334181-02 100 µL

SHH

Sign In for Pricing
View Details