Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CPD protein

This Human CPD protein spans the amino acid sequence from region 383-461aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallocarboxypeptidase D gp180

UniProt

O75976

Expression Region

383-461aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis Rheodyne RheBuild Kit 7750E Valve
CHR2805 1 Each

Kinesis Rheodyne RheBuild Kit 7750E Valve

Sign In for Pricing
View Details
Cell division cycle associated 3 Rabbit Monoclonal Antibody [KD Validation]
E51K1903 40 µL

Cell division cycle associated 3 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
RPS6KL1 Antibody
OM635974-01 100 µL

RPS6KL1 Antibody

Sign In for Pricing
View Details
RPS6KL1 Antibody
OM635974-02 20 µL

RPS6KL1 Antibody

Sign In for Pricing
View Details
RPS6KL1 Antibody
OM635974-03 50 µL

RPS6KL1 Antibody

Sign In for Pricing
View Details
Anti-FATE1 Mouse Monoclonal Antibody [Clone ID: OTI6F10]
M12412-2 100 µL

Anti-FATE1 Mouse Monoclonal Antibody [Clone ID: OTI6F10]

Sign In for Pricing
View Details