Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CPD protein

This Human CPD protein spans the amino acid sequence from region 383-461aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallocarboxypeptidase D gp180

UniProt

O75976

Expression Region

383-461aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcoco2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4628705 3x 1.0 µg

Calcoco2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Fmr1 (NM_008031) Mouse Tagged ORF Clone Lentiviral Particle
MR209428L4V 200 µL

Fmr1 (NM_008031) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RNASEH2A Protein Lysate (Rat) with C-HA Tag
40211036 100 µg

RNASEH2A Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
MRPL24 siRNA (Mouse)
orb1841981-01 15 nmol

MRPL24 siRNA (Mouse)

Sign In for Pricing
View Details
MRPL24 siRNA (Mouse)
orb1841981-02 30 nmol

MRPL24 siRNA (Mouse)

Sign In for Pricing
View Details
Anti-h Albumin 6501 SPRN-5
MBS5680336-01 1 mg

Anti-h Albumin 6501 SPRN-5

Sign In for Pricing
View Details