Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CPD protein

This Human CPD protein spans the amino acid sequence from region 383-461aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Metallocarboxypeptidase D gp180

UniProt

O75976

Expression Region

383-461aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTFE Stirrer Bar Octahedral 64 x 10mm
STI4232 1 Each

PTFE Stirrer Bar Octahedral 64 x 10mm

Sign In for Pricing
View Details
Anti-CD11a / Integrin L / LFA-1 Chain Monoclonal Antibody (Clone: DF1524)
36-2604-100 100 µg

Anti-CD11a / Integrin L / LFA-1 Chain Monoclonal Antibody (Clone: DF1524)

Sign In for Pricing
View Details
ZCCHC11 antibody
70R-21375 50 μL

ZCCHC11 antibody

Sign In for Pricing
View Details
Rhodanese Lentiviral Activation Particles (m2)
sc-423534-LAC-2 200 µL

Rhodanese Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Human ZKSCAN2 Antibody
ANT-36502-100ug 100 µg

Human ZKSCAN2 Antibody

Sign In for Pricing
View Details
DMP1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0609604 1.0 µg DNA

DMP1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details