Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMP5 protein

This LAMP5 protein spans the amino acid sequence from region 30-234aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain and dendritic cell-associated LAMP Brain-associated LAMP-like protein

UniProt

Q5R5V2

Expression Region

30-234aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVGRCGHSESELQVFWVDRAYALKMLFVKESHNMSKGPEETWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCAVDEREQLEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

R Cadherin Rabbit Monoclonal Antibody
orb2989186-01 30 µL

R Cadherin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
R Cadherin Rabbit Monoclonal Antibody
orb2989186-02 50 µL

R Cadherin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
R Cadherin Rabbit Monoclonal Antibody
orb2989186-03 100 µL

R Cadherin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
R Cadherin Rabbit Monoclonal Antibody
orb2989186-04 200 µL

R Cadherin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Pradimicin L
orb2943129-01 10 mg

Pradimicin L

Sign In for Pricing
View Details
Pradimicin L
orb2943129-02 50 mg

Pradimicin L

Sign In for Pricing
View Details