Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Agr2 protein

This Mouse Agr2 protein spans the amino acid sequence from region 21-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Gob-4 Secreted cement gland protein XAG-2 homolog

UniProt

O88312

Expression Region

21-175aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRINA Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-12098R-BF680 100 µL

GRINA Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Mrps36 shRNA (UAS) - Lentiviral mouse Mrps36 shRNA (UAS) (100)
GTR15287394 1 Vial

Lentiviral mouse Mrps36 shRNA (UAS) - Lentiviral mouse Mrps36 shRNA (UAS) (100)

Sign In for Pricing
View Details
RUN And FYVE Domain Containing 1 (RUFY1) Antibody
abx331143 100 µL

RUN And FYVE Domain Containing 1 (RUFY1) Antibody

Sign In for Pricing
View Details
Rat Parathyroid Hormone Related Protein (PTHrP) ELISA Kit
EK16317 48 Tests

Rat Parathyroid Hormone Related Protein (PTHrP) ELISA Kit

Sign In for Pricing
View Details
APBA2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0102205 3x 1.0 µg

APBA2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal OXNAD1 Antibody (OTI1D1) [Alexa Fluor 700]
NBP2-73175AF700 0.1 mL

Mouse Monoclonal OXNAD1 Antibody (OTI1D1) [Alexa Fluor 700]

Sign In for Pricing
View Details