Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mt3 protein

This Mouse Mt3 protein spans the amino acid sequence from region 1-68aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth inhibitory factor Short name: GIF

UniProt

P28184

Expression Region

1-68aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEAEKCSCCQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNMBP siRNA (Human)
orb1860120-01 15 nmol

DNMBP siRNA (Human)

Sign In for Pricing
View Details
DNMBP siRNA (Human)
orb1860120-02 30 nmol

DNMBP siRNA (Human)

Sign In for Pricing
View Details
AZU1, ID (AZU1, Azurocidin, Cationic antimicrobial protein CAP37, Heparin-binding protein)
032346 200 µL

AZU1, ID (AZU1, Azurocidin, Cationic antimicrobial protein CAP37, Heparin-binding protein)

Sign In for Pricing
View Details
Human Phospholipase A2, membrane associated (PLA2G2A) ELISA Kit
AE27218HU-01 48 Tests

Human Phospholipase A2, membrane associated (PLA2G2A) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase A2, membrane associated (PLA2G2A) ELISA Kit
AE27218HU-02 96 Tests

Human Phospholipase A2, membrane associated (PLA2G2A) ELISA Kit

Sign In for Pricing
View Details
9430020K01Rik ORF Vector (Mouse) (pORF)
ORF037612 1.0 µg DNA

9430020K01Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details