Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MscL protein

This mscL protein spans the amino acid sequence from region 91-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P9WJN5

Expression Region

91-151aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VLPYNTLRKKGEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTESQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L1RE1 Protein Vector (Human) (pPM-C-HA)
PV090340 500 ng

L1RE1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Guinea pig Anti-Albumin Antibody ELISA Kit
MBS731990-01 48 Well

Guinea pig Anti-Albumin Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Albumin Antibody ELISA Kit
MBS731990-02 96 Well

Guinea pig Anti-Albumin Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Albumin Antibody ELISA Kit
MBS731990-03 5x 96 Well

Guinea pig Anti-Albumin Antibody ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Albumin Antibody ELISA Kit
MBS731990-04 10x 96 Well

Guinea pig Anti-Albumin Antibody ELISA Kit

Sign In for Pricing
View Details
Crystallin-alphaC Polyclonal Antibody
MBS2549321-01 0.02 mL

Crystallin-alphaC Polyclonal Antibody

Sign In for Pricing
View Details