Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCR4 protein

This Human CCR4 protein spans the amino acid sequence from region 309-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

K5-5 CD_antigen: CD194

UniProt

P51679

Expression Region

309-360aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD43, 84-3C1, mouse mab
691581 1 mL (100 µg/mL)

Anti-CD43, 84-3C1, mouse mab

Sign In for Pricing
View Details
Serine / Threonine / Tyrosine Kinase 1 Antibody
abx115454 100 µL

Serine / Threonine / Tyrosine Kinase 1 Antibody

Sign In for Pricing
View Details
3-O-Feruloyl-6′-O- (4-O-β-D-glucopyranosylferuloyl) sucrose
T83348-01 5 mg

3-O-Feruloyl-6′-O- (4-O-β-D-glucopyranosylferuloyl) sucrose

Sign In for Pricing
View Details
3-O-Feruloyl-6′-O- (4-O-β-D-glucopyranosylferuloyl) sucrose
T83348-02 50 mg

3-O-Feruloyl-6′-O- (4-O-β-D-glucopyranosylferuloyl) sucrose

Sign In for Pricing
View Details
Anti-TNFSF18 antibody
STJ29108 100 µl

Anti-TNFSF18 antibody

Sign In for Pricing
View Details
ZNF496 siRNA (Human)
CRJ3639-01 15 nmol

ZNF496 siRNA (Human)

Sign In for Pricing
View Details