Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCR4 protein

This Human CCR4 protein spans the amino acid sequence from region 309-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

K5-5 CD_antigen: CD194

UniProt

P51679

Expression Region

309-360aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SPATA45 shRNA (UAS) - Lentiviral human SPATA45 shRNA (UAS, GFP) (100)
GTR15100545 1 Vial

Lentiviral human SPATA45 shRNA (UAS) - Lentiviral human SPATA45 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit LFA-1 (Lymphocyte Function Associated Antigen 1) ValidElisa Kit
EK346750 96 Well

Rabbit LFA-1 (Lymphocyte Function Associated Antigen 1) ValidElisa Kit

Sign In for Pricing
View Details
(2R,3R) -2-Aminobutane-1,3-diol hydrochloride
EDA47465-01 5 g

(2R,3R) -2-Aminobutane-1,3-diol hydrochloride

Sign In for Pricing
View Details
(2R,3R) -2-Aminobutane-1,3-diol hydrochloride
EDA47465-02 50 g

(2R,3R) -2-Aminobutane-1,3-diol hydrochloride

Sign In for Pricing
View Details
SLC3A1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
44192126 3x 1.0µg DNA

SLC3A1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Mouse CD3e Antibody : Biotin
OASB01660-500UG 0.5 mg

Mouse CD3e Antibody : Biotin

Sign In for Pricing
View Details