Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Chi3l1 protein

This Rat Chi3l1 protein spans the amino acid sequence from region 20-381aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cartilage glycoprotein 39

UniProt

Q9WTV1

Expression Region

20-381aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YKLVCYYTNWSQYREGNGSCFPDALDHSLCTHIIYSFANISNNKLSTSEWNDVTLYGMLNTLKTRNPRLKTLLSVGGWSFGSERFSRIVSNAKSRKTFVQSVAPFLRTYGFDGLDLAWLYPGPKDKQHFTTLIKELKAEFTKEVQPGTEKLLLSAAVSAGKVTLDSGYDVAQIAQHLDFINLMTYDFHGTWRHTTGHHSPLFRGQQDTGPDRFSNVDYGVGYMLRLGAPTNKLVMGIPTFGKSFTLASSENQVGAPITGSGLPGRYTKEKGTLAYYEICDFLRGAEVHRILGQQVPFATKGNQWVGYDDPESVKNKVKYLKNKQLAGAMVWAVDLDDFRGSFCGHNVHFPLTNAIKEALAVA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NEUROG2 sgRNA gene knockout kit - Lentiviral human NEUROG2 sgRNA gene knockout kit (25)
GTR15372705 1 Vial

Lentiviral human NEUROG2 sgRNA gene knockout kit - Lentiviral human NEUROG2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
DEC2 rabbit pAb
ES7574-01 50 µL

DEC2 rabbit pAb

Sign In for Pricing
View Details
DEC2 rabbit pAb
ES7574-02 100 µL

DEC2 rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal Gelsolin/GSN Antibody (20) [DyLight 405]
NBP1-05161V 0.1 mL

Mouse Monoclonal Gelsolin/GSN Antibody (20) [DyLight 405]

Sign In for Pricing
View Details
UBA1, NT (UBA1, A1S9T, UBE1, Ubiquitin-like modifier-activating enzyme 1, Protein A1S9, Ubiquitin-activating enzyme E1) (Biotin)
MBS6360521-01 0.2 mL

UBA1, NT (UBA1, A1S9T, UBE1, Ubiquitin-like modifier-activating enzyme 1, Protein A1S9, Ubiquitin-activating enzyme E1) (Biotin)

Sign In for Pricing
View Details
UBA1, NT (UBA1, A1S9T, UBE1, Ubiquitin-like modifier-activating enzyme 1, Protein A1S9, Ubiquitin-activating enzyme E1) (Biotin)
MBS6360521-02 5x 0.2 mL

UBA1, NT (UBA1, A1S9T, UBE1, Ubiquitin-like modifier-activating enzyme 1, Protein A1S9, Ubiquitin-activating enzyme E1) (Biotin)

Sign In for Pricing
View Details