Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human papillomavirus type 6a protein E4 protein

This Human papillomavirus type 6a protein E4 protein spans the amino acid sequence from region 1-91aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q84295

Expression Region

1-91aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human papillomavirus type 6a

Field of Research

Developmental Biology, Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADDSALHKKYPFLNLLHTPPHRPPPLCPQAPRKTQCKRRLENEHEESNSHLATPCVWPTLDPWTVETTTSSLTITTSTKEGTTVTVQLRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mupp1 (MPDZ) Rabbit Polyclonal Antibody
TA378611 100 µL

Mupp1 (MPDZ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SMAD2 (NM_001003652) Human Over-expression Lysate
LC400372 20 µg

SMAD2 (NM_001003652) Human Over-expression Lysate

Sign In for Pricing
View Details
Acetophenazine-d4 Dimaleate
TRC-A163932-1MG 1 mg

Acetophenazine-d4 Dimaleate

Sign In for Pricing
View Details
EWSR1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G3]
TA813055AM 100 µL

EWSR1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G3]

Sign In for Pricing
View Details
Il2 Mouse Gene Knockout Kit (CRISPR)
KN308264BN 1 Kit

Il2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), CF594 conjugate, 0.1mg/mL
BNC940880-500 1x 500 µL

P57 / KIP2 (KIP2/880), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details