Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine SNCA protein

This Porcine SNCA protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3I5G7

Expression Region

1-140aa

Tag

Tag-Free

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFHD1 Human Gene Knockout Kit (CRISPR)
KN400956 1 Kit

EFHD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS506578 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
BAMBI Mouse Monoclonal Antibody [Clone ID: OTI5D5]
CF807759 100 µg

BAMBI Mouse Monoclonal Antibody [Clone ID: OTI5D5]

Sign In for Pricing
View Details
Tau (MAPT) Rabbit Polyclonal Antibody
AP09498PU-N 100 µL

Tau (MAPT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Benzyl 2,3,4-Tri-O-benzyl-Beta-D-glucopyranoside
TRC-B315870-25MG 25 mg

Benzyl 2,3,4-Tri-O-benzyl-Beta-D-glucopyranoside

Sign In for Pricing
View Details
UBE2D2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H1]
TA806599BM 100 µL

UBE2D2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H1]

Sign In for Pricing
View Details