Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine SNCA protein

This Porcine SNCA protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3I5G7

Expression Region

1-140aa

Tag

Tag-Free

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMC1 (SMC1A) Rabbit Polyclonal Antibody
AP06318PU-N 100 µg

SMC1 (SMC1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HGF (NM_001010931) Human Over-expression Lysate
LC423236 20 µg

HGF (NM_001010931) Human Over-expression Lysate

Sign In for Pricing
View Details
MOG Antibody
KC-971-01 50 μL

MOG Antibody

Sign In for Pricing
View Details
MOG Antibody
KC-971-02 100 µL

MOG Antibody

Sign In for Pricing
View Details
MOG Antibody
KC-971-03 1 mL

MOG Antibody

Sign In for Pricing
View Details
Human SLC43A2 activation kit by CRISPRa
GA114871 1 Kit

Human SLC43A2 activation kit by CRISPRa

Sign In for Pricing
View Details