Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine SNCA protein

This Porcine SNCA protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q3I5G7

Expression Region

1-140aa

Tag

Tag-Free

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
CD81 / TAPA-1 (C81/2885R), 0.2mg/mL
BNUB2885-500 1x 500 µL

CD81 / TAPA-1 (C81/2885R), 0.2mg/mL

Sign In for Pricing
View Details
Tcim Mouse Gene Knockout Kit (CRISPR)
KN300185RB 1 Kit

Tcim Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Goat anti-Mouse IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB25F4-aM 10x 96 Well Plates

Goat anti-Mouse IgG Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details