Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

InaX protein

This inaX protein spans the amino acid sequence from region 1412-1567. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P18127

Expression Region

1412-1567

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Xanthomonas campestris pv. translucens

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGDRSKLIAGADSTQTAGDRSKLLAGRNSYLTAGDRSKLTAGDDSTLMAGDRSKLTAGKNSVLTAGANSRLIGSLGSTLSGGENSTLIFRCWDGERYTNLVVRTGEQGVESDIPYQVDDEGNLVGKADDDLVLDYDPGMILDGQCSPGTGEELRDV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse URM1 Protein, His (Fc)-Avi-tagged
URM1-9938M 50 µg

Recombinant Mouse URM1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
DiagSupport™ Fmoc-Gly-Rink Amide PEG-Polystyrene Resin, 90 µm, 0.2-0.25 mmol/g
SPS-RA23-426 1 g

DiagSupport™ Fmoc-Gly-Rink Amide PEG-Polystyrene Resin, 90 µm, 0.2-0.25 mmol/g

Sign In for Pricing
View Details
5β-Pregnan-3α-ol-20-one
sc-210430A 10 mg

5β-Pregnan-3α-ol-20-one

Sign In for Pricing
View Details
Qual Set Base Cont Low Range 0.05M to 0.99M - 250ML
AQSB001 250 mL

Qual Set Base Cont Low Range 0.05M to 0.99M - 250ML

Sign In for Pricing
View Details
KCNV2 Antibody
MBS859226-01 0.1 mg

KCNV2 Antibody

Sign In for Pricing
View Details
KCNV2 Antibody
MBS859226-02 0.1 mL (AF405L)

KCNV2 Antibody

Sign In for Pricing
View Details