Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

InaX protein

This inaX protein spans the amino acid sequence from region 1412-1567. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P18127

Expression Region

1412-1567

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Xanthomonas campestris pv. translucens

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGDRSKLIAGADSTQTAGDRSKLLAGRNSYLTAGDRSKLTAGDDSTLMAGDRSKLTAGKNSVLTAGANSRLIGSLGSTLSGGENSTLIFRCWDGERYTNLVVRTGEQGVESDIPYQVDDEGNLVGKADDDLVLDYDPGMILDGQCSPGTGEELRDV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP6 Rabbit Polyclonal Antibody (Carrier-free)
orb3098331 100 µg

SP6 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Cyp2j10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV631383 1.0 µg DNA

Cyp2j10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
VDAC3 Antibody
E51A11811 100 µL

VDAC3 Antibody

Sign In for Pricing
View Details
Mouse Macir activation kit by CRISPRa
GA205468 1 Kit

Mouse Macir activation kit by CRISPRa

Sign In for Pricing
View Details
VCAM-1, Peptide Aptamer, unlabeled
AP-333-U 5 mg

VCAM-1, Peptide Aptamer, unlabeled

Sign In for Pricing
View Details
BLZF1 (HRP)
556517-01 50 µg

BLZF1 (HRP)

Sign In for Pricing
View Details