Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AcpS protein

This acpS protein spans the amino acid sequence from region 1-119aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4'-phosphopantetheinyl transferase AcpS

UniProt

P63471

Expression Region

1-119aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus agalactiae serotype III (strain NEM316)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIVGHGIDLQEIEAITKAYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALGTGIGKVNFHDIEILSDDKGAPLITKEPFNGKSFVSISHSGNYAQASVILEEEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOCK4 (KIAA0716) discontinued
508870 100 µg

DOCK4 (KIAA0716) discontinued

Sign In for Pricing
View Details
RNF19B Peptide - C-terminal region
orb2003468 100 µg

RNF19B Peptide - C-terminal region

Sign In for Pricing
View Details
CHFR Rabbit Polyclonal Antibody (Cy5.5)
orb1043518 100 µL

CHFR Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
IRAK 2, CT (Interleukin-1 Receptor-associated Kinase 2, IL-1 Receptor-associated Kinase 2, Interleukin-1 Receptor-associated Kinase-like 2, IL-1 Receptor-associated Kinase-like 2, IRAK2, IRAK-2, MGC150550) (MaxLight 650) discontinued
I8600-12C-ML650 100 µL

IRAK 2, CT (Interleukin-1 Receptor-associated Kinase 2, IL-1 Receptor-associated Kinase 2, Interleukin-1 Receptor-associated Kinase-like 2, IL-1 Receptor-associated Kinase-like 2, IRAK2, IRAK-2, MGC150550) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Recombinant Biopolymer transport protein exbB (exbB)
orb2928933-01 20 µg

Recombinant Biopolymer transport protein exbB (exbB)

Sign In for Pricing
View Details
Recombinant Biopolymer transport protein exbB (exbB)
orb2928933-02 100 µg

Recombinant Biopolymer transport protein exbB (exbB)

Sign In for Pricing
View Details