Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HbhA protein

This hbhA protein spans the amino acid sequence from region 2-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adhesin

UniProt

P9WIP8

Expression Region

2-199aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potato Infusion Agar
30620066-1 500 g

Potato Infusion Agar

Sign In for Pricing
View Details
VISA antibody
70R-6462 50 ug

VISA antibody

Sign In for Pricing
View Details
Iigp1b sgRNA CRISPR Lentivector set (Mouse)
K4322001 3x 1.0 µg

Iigp1b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Manbal sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4534703 1.0 µg DNA

Manbal sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Easypro Human Complement Ic3B (iC3b) ELISA Kit
FY-EH2829S 96 Well

Easypro Human Complement Ic3B (iC3b) ELISA Kit

Sign In for Pricing
View Details
SLC30A8 siRNA (Mouse)
orb1835869-01 15 nmol

SLC30A8 siRNA (Mouse)

Sign In for Pricing
View Details