Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LpqE protein

This lpqE protein spans the amino acid sequence from region 30-182aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P9WK62

Expression Region

30-182aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGAGQISQTANQKPAVNGNRLTINNVLLRDIRIQAVQTSDFIQPGKAVDLVLVAVNQSPDVSDRLVGITSDIGSVTVAGDARLPASGMLFVGTPDGQIVAPGPLPSNQAAKATVNLTKPIANGLTYNFTFKFEKAGQGSVMVPISAGLATPHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P38 Rabbit Polyclonal Antibody
E28PT3513 100 µL

P38 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATP5L2 Double Nickase Plasmid (h2)
sc-415275-NIC-2 20 µg

ATP5L2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
HSP90α Rabbit pAb Antibody
orb763847-01 50 μL

HSP90α Rabbit pAb Antibody

Sign In for Pricing
View Details
HSP90α Rabbit pAb Antibody
orb763847-02 100 µL

HSP90α Rabbit pAb Antibody

Sign In for Pricing
View Details
PLEK2 Rabbit pAb
E45R23892N 50 ul

PLEK2 Rabbit pAb

Sign In for Pricing
View Details
OVA Conjugated C-Type Natriuretic Peptide (CNP)
SDPA456Ra21-01 10 µg

OVA Conjugated C-Type Natriuretic Peptide (CNP)

Sign In for Pricing
View Details